SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003054 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003054
Domain Number 1 Region: 81-311
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 2.88e-53
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0032
Further Details:      
 
Domain Number 2 Region: 1-80
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 1.15e-16
Family Nicotinic receptor ligand binding domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003054   Gene: ENSPANG00000006774   Transcript: ENSPANT00000000223
Sequence length 312
Comment pep:known_by_projection chromosome:PapAnu2.0:5:42302055:42404284:1 gene:ENSPANG00000006774 transcript:ENSPANT00000000223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKK
VEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITT
VLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGAS
KQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETGGSEVLTSVSDPKATMYSYDSASI
QYRKPLSSREAYGRTLDRHGVPSKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFS
LFNVVYWLYYVH
Download sequence
Identical sequences ENSPANP00000003054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]