SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003056 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003056
Domain Number 1 Region: 29-148
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-33
Family FKBP immunophilin/proline isomerase 0.00024
Further Details:      
 
Domain Number 2 Region: 151-217
Classification Level Classification E-value
Superfamily EF-hand 0.000000000109
Family Calbindin D9K 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003056   Gene: ENSPANG00000019540   Transcript: ENSPANT00000005785
Sequence length 222
Comment pep:known_by_projection chromosome:PapAnu2.0:12:40373340:40387361:-1 gene:ENSPANG00000019540 transcript:ENSPANT00000005785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHY
DGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMMDMCPGEKRKVVIPPSFAYG
KEGHAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDTDNDRQLSKAEINLYLQREFEK
DEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
Download sequence
Identical sequences A0A096MTC7
ENSPANP00000003056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]