SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003058 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003058
Domain Number 1 Region: 1210-1365,1401-1480
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-41
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1530-1721,1755-1780
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-37
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 765-912,946-993
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 136-276,366-435
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.59e-30
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003058
Domain Number - Region: 1789-1833
Classification Level Classification E-value
Superfamily EF-hand 0.0158
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003058   Gene: ENSPANG00000010874   Transcript: ENSPANT00000001633
Sequence length 1986
Comment pep:known_by_projection chromosome:PapAnu2.0:12:27029138:27113532:-1 gene:ENSPANG00000010874 transcript:ENSPANT00000001633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDNDDENGTINNSDSNSGFS
LCQVLFPRSPPSLTHNPAAVISFSYFLFQTFIVMNKGKAIFRFSATSALYILTPLNPVRK
IAIKILVHSYPFNNSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILAR
GFCLEDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTI
VGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSYFN
GTMDSNRTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAG
RNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLV
NLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAVAAASAASRDFSGI
GGLGELLESSSEASKLSSKSAKEWRNRRKKRRQREHHEGNNKGEKDSFPKSESEDSVKRS
SFLFSMDGNRLTSDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFAD
DEHSTFEDSESRRDSLFVPHRHGERRNSNVSQASMSSRMVPGLPANGKMHSTVDCNGVVS
LVGGPSALTSPTGQLLPEGTTTETEIRKRRLSSYQISMEMLEDSSGRQRAMSIASILTNT
MEELEESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITICIVLNTL
FMAMEHYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLS
LMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFI
FAVVGMQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVA
GQTMCLIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGI
DYVKNKIRECFRKAFFRKPKVIEIHEGNKIDSCMSNNTGIEISKELNYLRDGNGTTSGVG
TGSSVEKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKEKLNA
TSSSEGSTVDVALPREGEQAEIEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKGKIWWNL
RKTCYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEM
LLKWVAYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRAL
SRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTGNMFDV
SDVNNLSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRDVTLQ
PMYEENLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNA
MKKLGSKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQGKYMT
LVLSRINLVFIVLFTGEFVLKLVSLRHYYFTIGWNIFDFVVVILSIVGMFLAEMIEKYFV
SPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMS
NFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDTIHPGS
SVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYE
VWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFA
FTKRVLGESGEMDALRIQMEDRFMSSNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYL
LKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKSDGSSSTTSPPSYDSVTK
PMKVKY
Download sequence
Identical sequences ENSPANP00000003058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]