SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003061 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003061
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-38
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 6.55e-38
Family Link domain 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003061   Gene: ENSPANG00000021874   Transcript: ENSPANT00000009579
Sequence length 277
Comment pep:known_by_projection chromosome:PapAnu2.0:12:13627895:13650502:1 gene:ENSPANG00000021874 transcript:ENSPANT00000009579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILIYLFLLLWEEAQGWGFKDGIFHNSIWLERAAGVYHRESRSGKYKLTYAEAKAVCEF
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDSKRIFKSPGFPNEYEDNQICYWHIRLKYGQHIHLSFLDF
DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDQLPDDIISTGNVMTLKFLSDASVTAGGF
QIKYVAVDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences A0A096MTD2 A0A2K5ZTS8
XP_011843232.1.47321 ENSPANP00000003061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]