SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003074 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003074
Domain Number 1 Region: 260-310
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000353
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 2 Region: 193-228
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000235
Family CCCH zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003074   Gene: ENSPANG00000011522   Transcript: ENSPANT00000002973
Sequence length 344
Comment pep:known_by_projection chromosome:PapAnu2.0:X:108394701:108395735:-1 gene:ENSPANG00000011522 transcript:ENSPANT00000002973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQFSPGKTADQVCTFLFKKPGRKGAAGRRKRPACDPEPGDSGSSSDEGCTVVRPEKKR
ATHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVY
ELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRK
GPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGR
YGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCD
QQTNGVFNPAKELIAKLEKHRATGEGGGASDLPEDPDEDPIPVT
Download sequence
Identical sequences A0A096MTE5 A0A2K5KIL9 A0A2K5XMQ8 A0A2K6AYK4 F6V216 G7Q3K8
NP_001185630.1.72884 XP_005594524.1.63531 XP_011716836.1.29376 XP_011832559.1.47321 XP_011942959.1.92194 ENSMMUP00000026625 9544.ENSMMUP00000026625 ENSPANP00000003074 ENSMMUP00000026625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]