SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003097 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003097
Domain Number 1 Region: 1071-1106,1187-1282,1384-1630,1680-1718
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.74e-40
Family Tandem AAA-ATPase domain 0.052
Further Details:      
 
Domain Number 2 Region: 15-127
Classification Level Classification E-value
Superfamily TPR-like 1.36e-19
Family Tetratricopeptide repeat (TPR) 0.0018
Further Details:      
 
Domain Number 3 Region: 487-639
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000332
Family Ankyrin repeat 0.0071
Further Details:      
 
Domain Number 4 Region: 228-348
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000547
Family Ankyrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003097   Gene: ENSPANG00000018588   Transcript: ENSPANT00000016431
Sequence length 1769
Comment pep:known_by_projection chromosome:PapAnu2.0:2:98478096:98580480:1 gene:ENSPANG00000018588 transcript:ENSPANT00000016431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWDPRAARMDLTAYAELLKESGNQVLKNGNFSLAIRKYDEAIQILLQLYQWGVPPRDLAV
LLCNKSNAFFSLGKWNEAFVAAKECLQWDPTYVKGYYRAGYSLLRLHQSYEAARMFFEGL
RLVQRSQDQAPVADFLVGVFTTMSSDSIVLQSFLPCFDHIFTTGFPTEVWQSVIEKLAKK
GLWHSFLLLSAKKDRLPRNIHVPELSLKSLFEKYVFIGLYEKMEQVPKLVQWLISIGASV
ETIGPYPLHALMRLCIQARENHLFRWLMDHKPEWKGRINQKDGDGCTVLHVVAAHSPGYL
VKRQTEDVQMLLRFGADPTLLDRQSRSVVDVLKRNKNFKAIEKINSHLEKLATCSKDLSG
FSNGDGPTSENDIFRKVLEQLVKYMNSGNRLLHKNFLKQEVVQKFLRLLSTLQEIPPDLV
CDINQDCATIVFKFLLEKQKWPEVLLLLTRKVSGEPPLGDCLIKDCNFSDLDICTIIPHL
STWDQRKKQLLGRLIDSGALPDGLQESQERPLVMCLKYEDFELAFLLLTKGADPRAISLT
EGDTPLHAALHIFLEIKADIGFSFLNHLLDLFWSNPTEFDYLNPNVQDSNGNTLMHILFQ
KGMLKRMKKLLDLLVKFDINFNLKNKEGKDARHRIKKNDSLLLAWNKALMENRRRSRQDS
AAHLGKLPRSTAPGHTSQLKSQGSFKSVPCGATARTLPEGSAVPDSWETLPDTQVTREKP
GALRPCSLRDCLMQDITVLIQQIEVDPSFPEDCLQSSEPLEAGAGKEGKKDELQLTLGAG
VPDCSEAGEGHAQVGLGALQLVPADNRGKEGNDDQDDWSTQEIEACLQDFDNMTWEIECT
SEMLKKLSSKVMTKVIKKKIILAIQQLGNGEWTQGLQKRLKHLKGSIQLFEAKLDKGARM
LWELAIDFSPRCSENPEKIIATEQNTCAMEKSGRIYTEIIRIWDIVLDHCKLADSIKAIC
NAYNRGLSCVLRKKLKGINKGQVSANMKIQKRIPRCYVEDTEAEKGREHVNPEYFPPASA
VETEYNIMKFHSFSTNMAFNILNDTTATVEYPFRVGELEYAVIDLNPRPLEPIILIGRSG
TGKTTCCLYRLWKKFHVYWEKAEQAGSPLLAKQVWLKRRLEVEPGKEGPGGEEEEEEEEE
EEEGSIEVETESIDEQEYEAYAGGASVEPAGDGQAAEVCAPEHPHQLEHLHQIFVTKNHV
LCQEVQRNFIELSKSTKATSHYKPLDPNIHKLQDLRDENFPLFVTSKQLLLLLDASLPKP
FFLRNEDGSLKRTIIGWSTQEESTIPSWQEDEEEAEVDGDYSEEDKAVEMRTGDSDPRVY
VTFEVFKNEIWPKMTKGRTAYNPALIWKEIKSFLKGSFEALSCPCGRLTEEAYKKLGRKR
CPNFKEDRSEIYSLFCLYQQIRSQKGYFDEEDVLYNISRRLSKLRVLPWSIHELYGDEIQ
DFTQAELALLMKCINDPNSMFLTGDTAQSIMKGVAFRFSDLRSLFHYASRNTVDKQCAVR
KPKKIHQLYQNYRSHSGILNLASGVVDLLQFYFPESFDRLPRDSGLFDGPKPTVLESCSV
SDLAILLRGNKRKTQPIEFGAHQVILVANETAKEKIPEELGLALVLTIYEAKGLEFDDVL
LYNFFTDSEAYKEWKIISSFTPTSTDSREENRPLIEVPLDKPSSSQGRSLMVNPEMYKLL
NGELKQLYTAITRARVNLWIFDENREKRAPAFKYFIRRDFVQVVKTDENKGKILLKYSHC
WRNHVSTILLVRNKRCSFLKVLSFFSTIF
Download sequence
Identical sequences ENSPANP00000003097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]