SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003145 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003145
Domain Number 1 Region: 237-333
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 354-683
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.27e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 160-250
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000251
Family I set domains 0.037
Further Details:      
 
Domain Number 4 Region: 2-36
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000277
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Domain Number 5 Region: 82-154
Classification Level Classification E-value
Superfamily EF-hand 0.000000432
Family Calmodulin-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003145   Gene: ENSPANG00000003666   Transcript: ENSPANT00000013491
Sequence length 745
Comment pep:known_by_projection chromosome:PapAnu2.0:6:126774225:126976791:-1 gene:ENSPANG00000003666 transcript:ENSPANT00000013491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVCGSDGRFYENHCKLHRAACLLGKKITVIHSKDCFLKGDTCTIAGYARLKNVLLALQT
RLQPLREGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCS
PGDLLRFDDYNSDSSLTLREFYMAFQVVQLSLAPEDRVSVTTVTVGLSTVLTCAVRGDLR
PPIIWKRNGLTLNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQV
NVPPVIRVYPESQAQEPGVVASLRCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSE
LHISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVF
SDDGIIVIHPVDCEIQRHLKPTEKIFMSYEEICPQREKNATQPCQWASAVNVRNRYIYVA
QPALSRVLVVDIRAQKVLQSIGVDPLPAKLAYDKSHDQVWVLSWGDVHKSQPSLQVITEA
SAGQDQHLIRTPFAGVDDFFIPPTNLIINHIRFGFIFNKSDPAVHKVDLETLMPLKTIGL
HHHGCVPQAMAHTHLGGYFFIQCRQDSPASAAQQLLVDSVTDSVVGPNGDVTGTPHTSPD
GRFIVSAAADSPWLHVQEITVRGEIQTLYDLQINPGISDLAFQRSFTESNQYNIYAALHT
EPDLLFLELSTGKVGTLKNLKEPPTGPPQPWGGARRIMRDSGLFGQYLLTPARESLFLIN
GRQNTLRCEVSGIKGGTTVVWVGEV
Download sequence
Identical sequences ENSPANP00000003145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]