SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003151 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000003151
Domain Number - Region: 36-99
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000108
Family Cold shock DNA-binding domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003151   Gene: ENSPANG00000012503   Transcript: ENSPANT00000019115
Sequence length 264
Comment pep:known_by_projection chromosome:PapAnu2.0:X:123605776:123617047:1 gene:ENSPANG00000012503 transcript:ENSPANT00000019115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLLRLALAFYGRTADPAEQQGPQQQGLPQGDTQLKTVQGVVTSFCGDYGMIDESIFFS
SDVVSGNVPLKVGQKVNVVVEDDKPLYGFRAIKVDVVPHRLYGAVPSDSGTRVLIGCVTS
ISEDTIYISNSIYFSIDIFSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPTRCIHVEEV
CVTSVHGRNGVIDYTIFFTLDSVKLPDGYIPQVYDIVNVVMVESIQFCYIWRAVSVTPAQ
KSSSGFQDDGGLGRPKKERRSQSI
Download sequence
Identical sequences ENSPANP00000003151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]