SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003163 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003163
Domain Number 1 Region: 14-125
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.31e-35
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003163   Gene: ENSPANG00000017121   Transcript: ENSPANT00000017469
Sequence length 130
Comment pep:known_by_projection chromosome:PapAnu2.0:X:15891840:15899127:-1 gene:ENSPANG00000017121 transcript:ENSPANT00000017469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRGSLPVTWYVLGRCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQ
YRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRM
ELLECVSKCA
Download sequence
Identical sequences ENSPANP00000003163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]