SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003166 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003166
Domain Number 1 Region: 452-598
Classification Level Classification E-value
Superfamily TPR-like 1.64e-35
Family Tetratricopeptide repeat (TPR) 0.0051
Further Details:      
 
Domain Number 2 Region: 168-420
Classification Level Classification E-value
Superfamily HCP-like 3.92e-27
Family HCP-like 0.011
Further Details:      
 
Domain Number 3 Region: 636-765
Classification Level Classification E-value
Superfamily TPR-like 1.04e-16
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 4 Region: 111-199
Classification Level Classification E-value
Superfamily TPR-like 0.000000221
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003166   Gene: ENSPANG00000019132   Transcript: ENSPANT00000017949
Sequence length 1174
Comment pep:known_by_projection chromosome:PapAnu2.0:14:54193307:54220913:-1 gene:ENSPANG00000019132 transcript:ENSPANT00000017949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGSIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALAVSIHYKQGKTEE
FVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTM
ADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDY
RGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLA
VLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNT
EVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKEN
ASQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELA
QILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLD
RAKAEAEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGA
MARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQS
DTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAH
KGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEV
VLYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLKDEKSNLKEV
LNAVKELELAHRYFSYLSKVGDKMRFDLALAATEARQCSDLLSQAQYHVARARKQDEEER
ELRAKQEQEKELLRQKLLKEQEEKRLREKEEQKKLLEQRAQYVEKTKNILMFTGETEATK
EKKRGGGGGRRSKKGGEFDEFVNDDTDDDLPISKKKKRRKGSGSEQEGEDEEGGERKKKK
RRRLPKGEEGSDDDETENGPKQKKRRPPRAEKKKAPKPERLPPSMKGKIKSKAIISSSDD
SSDEDKLKIADEGHPRNSNSNSDSDEDEQRKKHASSESDSDENQNKSGSEAGSPRRPRRQ
RSDQDSDSDQPSRKRRPSGSEQSDNESVQSGRSRSGVSENDSRPASPSAESDHESERGSD
NEGSGQGSGNESEPEGSNNEASDRGSEHGSDDSD
Download sequence
Identical sequences ENSPANP00000003166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]