SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003176 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003176
Domain Number 1 Region: 1076-1277
Classification Level Classification E-value
Superfamily TPR-like 3.41e-28
Family Tetratricopeptide repeat (TPR) 0.0029
Further Details:      
 
Domain Number 2 Region: 927-1045
Classification Level Classification E-value
Superfamily TPR-like 1.02e-16
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 3 Region: 488-719
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000286
Family Phosphoribulokinase/pantothenate kinase 0.066
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003176
Domain Number - Region: 80-178
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0628
Family Outer membrane efflux proteins (OEP) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003176   Gene: ENSPANG00000010239   Transcript: ENSPANT00000017636
Sequence length 1316
Comment pep:known_by_projection chromosome:PapAnu2.0:2:153091879:153132863:1 gene:ENSPANG00000010239 transcript:ENSPANT00000017636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTASSLVSPAGGEVIEDTYGAGGGEACEIPVEVKPKARLLRNSFRPGAGGLLGASFKST
GSSVPELEYAAAEYERLKKEYEIFRVSKNQELLSMGRREAKLDTENKRLRAELQALQKTY
QKILREKESALEAKYQAMERAATFEHDRDKVKRQFKIFRETKENEIQDLLRAKRELESKL
QRLQAQGIQVFDPEESDSDDNCTDVTAAGTQCEYWTGGALGSEPSIGSMIQLQQSFRGPE
FAHSSIDVEGPFANVNRDDWDIAVASLLQVTPLFSHSLWSNTVRCYLIYTDETQPEMDLF
LKDYSPKLKRMCETMGYFFHAVYFPIDVENQYLTVRKWEIEKSSLVILFIHLTLPSLLLE
DCEEAFLKNPEGKPRLIFHRLEDGKVSSDSVQQLIDQVSSRNKTNKAKIIDHSGDPAEGV
YKTYLCVEKIIKQDILGFENTDLETKDLGSEDSIPEEDDFGDVPWDIHDEQEQMETFQQA
SSSAHELGFEKYYQRLNDLVAAPAPIPPLLVSGGPGSGKSLLLSKWIQLQQKNSPNTLIL
SHFVGRPMSTSSESSLIIKRLTLKLMQHSWSVSALTLDPAKLLEEFPRWLEKLSARHQGS
IIIVIDSIDQVQQVEKHMKWLIDPLPVNVRVIVSVNVETCPPAWSKRLWPTLHLDPLSPK
DAKSVIIAECHSVDIKLSKEQEKKLERHCRSATTCNALYVTLFGKMIARAGRAGNLDKIL
HQCFQCQDTVSLYRLVLHSIQESMADDVDKELMKQILCLVNVSHNGVSESELMELYPEMS
WTFLTSLIHNLYKMCLLTYGCGLLRFQHLQAWETVRLEYLEDPTVTSSYRQKLINYFTLQ
LSQDRVTWRSADELPWLFQQQGSKQKLHDCLLNLFVSQNLYKRNRGHFAELLSYWQFVGK
DKSAMATEYFDSLKQYEKNCEGEENMSCLADLMKLGRFLKDLGLLSQAVVPLQRSLEIRE
TALDPDHPRVAQSLHQLASVYVQWKKFGNAEQLYKQALEISENAYGADHPYTARELEALA
TLYQKQNKYEQAEHFRKKSFKIRQKAIKKKGNLYGFALLRRRALQLEELTLGKDTPDNAR
TLNELGVLYYLQNNLETADQFLKRSLEMRERVLGPDHPDCAQSLNNLAALCNEKKQYDKA
EELYERALDIRRRALAPDHPSLAYTVKHLAILYKKMGKLDKAVPLYELAVEIRQKSFGPK
HPSVATALVNLAVLYSQMKKHVEALPLYERALKIYEDSLGQMHPRVGETLKNLAVLSYEG
GDFEKAAELYKRAMEIKEAETSLLGGKAPSHHSSSGDTFSLKTAHSPNVFLQQGQR
Download sequence
Identical sequences ENSPANP00000003176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]