SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003196 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003196
Domain Number 1 Region: 421-490,527-740
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000494
Family Rhodopsin-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003196
Domain Number - Region: 51-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0226
Family Integrin beta EGF-like domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003196   Gene: ENSPANG00000006084   Transcript: ENSPANT00000022739
Sequence length 799
Comment pep:known_by_projection chromosome:PapAnu2.0:2:20525746:20601964:1 gene:ENSPANG00000006084 transcript:ENSPANT00000022739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCRAWNIRVLVAVVCGLLTGIILGLGIWRIVIRIQRVGISATSSSTPTEFCRNGGTWE
NGRCVCTEEWKGLRCTIAGFCEKSTYMGFTFARIPVGRYGPSLQTCGKGTPNEAGNPMAV
RLCSLSPYGEIELQNVTIGNCNENLETLEEQQVKDVTAPLNNISSEVQILTSDANKLTAE
NISSATRVVGQIFNTSRNASPEAKKIAIVTVSQLLDASGDAFQEAAATANNDALTTLIEQ
METYSLSLGNESVVEPNIAIQSANFSSKDAVGPLNVRFSVQKGASSSLLSGSTFIHTNVD
GLNPDGQTELQVLLNMTKSNSKACGFVVYQNDKLFQSKTFTAKSNFSQKIISSKTDENEQ
DQSASVDMVFSPRYNQREFQLYSYACVYWNLSTRDWDTYGCQKHKGTDGFLRCHCNHTTN
FAVLMTFKKDYQYPKSLDVFSNVGCALSITGLALTIVFQIVTRKVRKTSVTWVLVNLCIS
MLIFNLLFVFGIENSNKNKTSDGDIHDIDFKNNDVPQTDTINDSNPTCTAIAALLHYFLL
VTFTWNALSAAQLYFLLIRTMKPLPRHFILFISLIGWGVPAIVVAITVGVIYSQNGKNPQ
WELDYRQEIICWLAIPEPDGVTKSPLLWSFILPVTIILISNVVIFITISIKVLWKNNQNL
TSTKKVSSMRKIVSTLSVAVVFGITWILAYLMLVNDDSIRIIFSYIFCLFNTTQGVQIFF
LHTVRTKIFQTEASKVLTLLLSIGRRKSLSSVTRPRLRVRMYNFLRSLPTLHEHFRLLET
SRSTEDITFSESDKAKESI
Download sequence
Identical sequences ENSPANP00000003196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]