SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003197 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003197
Domain Number 1 Region: 112-215
Classification Level Classification E-value
Superfamily TPR-like 1.36e-26
Family Tetratricopeptide repeat (TPR) 0.001
Further Details:      
 
Domain Number 2 Region: 304-595
Classification Level Classification E-value
Superfamily TPR-like 2.11e-24
Family Tetratricopeptide repeat (TPR) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003197   Gene: ENSPANG00000025904   Transcript: ENSPANT00000017267
Sequence length 608
Comment pep:known_by_projection chromosome:PapAnu2.0:2:20293164:20328871:-1 gene:ENSPANG00000025904 transcript:ENSPANT00000017267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASKPVEAAVVAAAAPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWS
RQQRRRESRGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNK
GNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAV
ELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKA
KEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKENSGYLK
AKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKPDLDKVISLKE
ANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEA
VADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYA
LYAQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEI
DNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKK
YGLKPPTL
Download sequence
Identical sequences A0A096MTQ6 A0A0D9R171 A0A2K5LYQ2 A0A2K6MUR7 A0A2K6NAF4
XP_007984244.1.81039 XP_010367143.1.97406 XP_011940395.1.92194 XP_017747381.1.44346 ENSPANP00000003197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]