SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003206 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003206
Domain Number 1 Region: 609-670
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-16
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003206
Domain Number - Region: 258-317
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0116
Family Thioltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003206   Gene: ENSPANG00000017764   Transcript: ENSPANT00000019239
Sequence length 685
Comment pep:known_by_projection chromosome:PapAnu2.0:13:85349452:85368519:-1 gene:ENSPANG00000017764 transcript:ENSPANT00000019239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLKLFFLLLYFLVLFVLARFFEAIVWYETGIFASQLVDPVALSFKKLKTILECRGLGYS
GLPEKKDVRELVEKSGDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWL
VQVIANDRSPLVGKIHWEKMVKKVSRFGIRTGTFNCSSDPRYCRRRGWVRSTLIMSVPQT
STSKGKVMLKEYSGRKIEVEHIFKWITAHAASRIKTIYNAEHLKEEWNKSDQYWLKIYLF
ANLDQPPAFFSALSIKFTGRVEFIFVNVENWDNKSYMTDIGIYNMPSYILRTPEGIYRYG
NHTGEFISLQAMDSFLRSLQPEVNDLFVLSLVLVNLMAWMDLFITQGATIKRFVVLISTL
GTYNSLLIISWLPVLGFLQLPYLDSFYEYSLKLLRYSNTTTLASWVRADWMFYSSHPALF
LSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVES
DWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSEEEMSEGSQDTENDSE
SENTYTLSSEKEVFEDKQSVFHNSPGRASHCDAEACSCANKYCQTSPYERKGRSYGSYNA
NEDMEPDWLTWPADMLHCTECVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCP
VCRWPSYKKKQPYAQHQPLSNDVPS
Download sequence
Identical sequences A0A096MTR5
ENSPANP00000003206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]