SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003210 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003210
Domain Number 1 Region: 245-361
Classification Level Classification E-value
Superfamily PH domain-like 6.89e-35
Family Phosphotyrosine-binding domain (PTB) 0.00000973
Further Details:      
 
Domain Number 2 Region: 103-236
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000389
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003210   Gene: ENSPANG00000009011   Transcript: ENSPANT00000011006
Sequence length 557
Comment pep:known_by_projection chromosome:PapAnu2.0:13:73420262:73422821:1 gene:ENSPANG00000009011 transcript:ENSPANT00000011006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRAATTSRGQGPRAKTKYFRWSYRRAPTTAGRGLGSARLIRGPPPFLLALLPHPTATP
QRPPVGAGEGRKRLQGTRPRLPPRLPPRLPPQGQEARKEPPGAMDGAVMEGPLFLQSQRF
GTKKWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGSSRRLDCKVIRLAECVSVAPVT
VETPPEPGATAFRLDTAQRSHLLAADAPSSAAWVQTLCRNAFPKGSWTLAPSDNPPKLSA
LEMLENSLYSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVETERLTLLTMGAQSQILEP
LLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQGK
ARQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSD
PLDSTPARAGEGVQRKKPLYWDLFEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLY
DLPREPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRSTKPLPAPKPEPGTATGSGSKS
YNSALYSQVHKSGASGS
Download sequence
Identical sequences ENSPANP00000003210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]