SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003216 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003216
Domain Number 1 Region: 74-139,178-315
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-23
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 344-507
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-21
Family Pleckstrin-homology domain (PH domain) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003216   Gene: ENSPANG00000024862   Transcript: ENSPANT00000006943
Sequence length 768
Comment pep:known_by_projection chromosome:PapAnu2.0:6:142841931:142906935:1 gene:ENSPANG00000024862 transcript:ENSPANT00000006943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGRVLEQLLPELTGLLSLLDHEYLSDTTLEKKMAVASILQSLQPLPAKEVSYLYVNTA
DLHSGPSFVESLFEEFDCDLSDLRDMPEDDGEPSKAASPEPAKSPCLRNAANLPPPLPNK
PPPEDYYEEALPLGPGKSPEYISSHNGCSPSHSIVDGYYEDADSSYPATRVNGELKSSYN
DSDAMSSSYESYDEEEEEGKSPQPRHQWPSEEASMHLVRECRICAFLLRKKRFGQWAKQL
TVIREDQLLCYKSSKDRQPHLRLALDTCSVIYVPKDSRHKRHELRFTQGATEVLVLSLQS
REQAEEWLKVIREVSKPVGGAEGVEVPRSPVLLCRLDPDKRLSQEKQTSDSDSVGMGDNC
STLGRRETCDHGKGKKSSLAELKGSMSRAAGRKITRIISFSKKKPLADDLQTSSTEEEVP
CCGYLNVLVNQGWKERWCRLKCNTLYFHKDHTDLRTHVNAIVLQGCEVAPGFGPRHPFAF
RILRNRQEVAILEASCSEDMGRWLGLLLVEMGSRVTPEALHYDYVDVETLTSIVSAGRNS
FLYARSCQNQWPEPRVYDDVPYEKMQDEEPERPTGAQVKRHASSCSEKSHRVDPQVKVKR
HASSANQYKYGKNRAEEDARRYLVEKEKLEKEKETIRTELIALRQEKRELKEAIRSSPGA
KLKALEEAVATLEAQCRSKEERRIDLELKLVAVKERLQQSLAGGPALGLSMSSKPKSGET
ANKPKSSVPEQSLPVNCVSELRKRSPSIVASNQGRVLQKAKEWEMKKT
Download sequence
Identical sequences A0A2I3MRB7 A0A2K5ZBL7
XP_011840779.1.47321 ENSPANP00000003216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]