SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003242 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003242
Domain Number 1 Region: 767-948
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.33e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 923-1042
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 3 Region: 158-192,224-370
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-31
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 3-163
Classification Level Classification E-value
Superfamily PH domain-like 9.57e-21
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003242   Gene: ENSPANG00000015230   Transcript: ENSPANT00000001608
Sequence length 1163
Comment pep:known_by_projection chromosome:PapAnu2.0:5:32624446:32856748:1 gene:ENSPANG00000015230 transcript:ENSPANT00000001608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPLPNEVSVDFGLHLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSSRKEPV
TKQVRLCVSPSGLRCEPEPGRSQQWDPLICSSIFECKPQHVHKLIHNSHDPSYFACLIKE
DAVHRQSICHVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSGSLGSEHAAPTWSQEPGRRPMRKSFSQPGLRSLAFR
KELQDGGLRSSGFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEVYLISPDT
KKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCANEALVDEIMMTL
KQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEVGMNSSKTKLELQKHLTTLTNQEQ
ATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIGEMKQTSQIAAENIGSELPP
SATRFRLDLLKNKAKRSLTESLESILSRGNKARGLQEHSSSVDLDSSLSSTLSNTSKEPS
VCEKEALPISESSFKLLGSSEDLSSDSESHLPEEPAPLSPQQAFRRRANTLSHFPMECQE
PPQPARGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSWRQQIF
LRVATPQKACDASSRYEDYSELGELPPRSPLEPVCEDGPFGPPPEEKKRTSRELRELWQK
AILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKI
KFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVPYKELLKQLTSQQH
AILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMSE
EEAFKMLKFLMFDVGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYA
APWFLTMFASQFPLGFVARVFDMIFLQGTEVIFKVALSLLGSHKPLILQHENLETIVDFI
KNTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRMDKLEKT
NSSLRKQNLDLLEQLQVANGRIQSLEATIEKLLSSESKLKQAMLTLELERSALLQTVEEL
RRGSASPSDLREPECTQPKPTGD
Download sequence
Identical sequences ENSPANP00000003242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]