SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003243 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003243
Domain Number 1 Region: 427-538
Classification Level Classification E-value
Superfamily SH2 domain 1.13e-32
Family SH2 domain 0.00000496
Further Details:      
 
Domain Number 2 Region: 102-198
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-30
Family Ras-binding domain, RBD 0.00034
Further Details:      
 
Domain Number 3 Region: 229-344
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000904
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003243   Gene: ENSPANG00000008395   Transcript: ENSPANT00000021535
Sequence length 541
Comment pep:known_by_projection chromosome:PapAnu2.0:12:26424256:26554640:-1 gene:ENSPANG00000008395 transcript:ENSPANT00000021535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSLQDGQSAAGRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHAGALLPPPDGTRGC
AADRRKKKDLDVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSR
ALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIE
EENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGF
LHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKKEPRHLQFFSEFGNSDIYVSLAGKKKHG
APTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSG
CSSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGS
PTASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSM
SHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIA
L
Download sequence
Identical sequences ENSPANP00000003243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]