SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003264 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003264
Domain Number 1 Region: 128-293
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003264   Gene: ENSPANG00000008710   Transcript: ENSPANT00000016218
Sequence length 363
Comment pep:known_by_projection chromosome:PapAnu2.0:11:98098913:98188615:-1 gene:ENSPANG00000008710 transcript:ENSPANT00000016218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFQVLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLREPSGNHTPPQLSPSLSQSTY
TTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQQSSVCEIWTNQNAGFPFSAI
HQVHNTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRG
TESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAA
QDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGH
SSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYET
TIF
Download sequence
Identical sequences A0A0D9S108
ENSPANP00000003264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]