SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003270 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003270
Domain Number 1 Region: 424-580
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-33
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 2 Region: 1662-1815
Classification Level Classification E-value
Superfamily Spectrin repeat 2.68e-32
Family Spectrin repeat 0.0000121
Further Details:      
 
Domain Number 3 Region: 318-469
Classification Level Classification E-value
Superfamily Spectrin repeat 3.22e-32
Family Spectrin repeat 0.00066
Further Details:      
 
Domain Number 4 Region: 741-896
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-30
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 5 Region: 637-789
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-30
Family Spectrin repeat 0.00047
Further Details:      
 
Domain Number 6 Region: 1449-1594
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-28
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 7 Region: 1237-1389
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-27
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 8 Region: 122-260
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 9 Region: 19-154
Classification Level Classification E-value
Superfamily Spectrin repeat 6.12e-27
Family Spectrin repeat 0.000000237
Further Details:      
 
Domain Number 10 Region: 1769-1925
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-25
Family Spectrin repeat 0.0000997
Further Details:      
 
Domain Number 11 Region: 2038-2150
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-24
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 12 Region: 977-1058
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-20
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 13 Region: 900-964,1042-1080
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-18
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 14 Region: 1895-2031
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-18
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 15 Region: 2157-2264
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-17
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 16 Region: 2257-2392
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000207
Family Calmodulin-like 0.016
Further Details:      
 
Domain Number 17 Region: 1088-1182
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000892
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003270   Gene: ENSPANG00000005568   Transcript: ENSPANT00000004948
Sequence length 2420
Comment pep:known_by_projection chromosome:PapAnu2.0:1:132501559:132583580:-1 gene:ENSPANG00000005568 transcript:ENSPANT00000004948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQRFKERVAERGQKLEDSYHLQVFKR
DADDLGKWIMEKVNILNDESYGDPTNIQGKYQKHQSFEAEVQTKSRVMSELEKTREERFT
MGHSAHEETKAHIEELRRLWDLLLELTLEKGALLLRALKFQQYVQECADILEWIGDKEAI
ATSVELGEDWERTEVLQKKFEDFQVDLVAKEGRVDDVNQYANECAEEKHPELPLIQSKQE
EVNAAWERLRGLALQRQKALSSAADLQRFKRDMTDAIQWIKEKEPVLTSEDYGKDLVASE
GLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSNWEHIRALAT
SRYEKLQATYWYHRFSSDFDELSGWMKEKTAAINADELPTDVAGGEVLLDRHQQHKHEID
SYDDRFQSAKETGEDLLDANHEASDEVREKMEILASNWDALLELWDQRHRQYEQCLDFHL
FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHDDFEEAFTAQEEKITTVDKTAT
KLIGDNHYDSENIAAIRDGLLARRDALRGRATTRRRLLEDSLLLQQLYQDSDDLKNWINK
KKKLADDEDYKDTQNLKSRVQKQQVFKKELADNEIVLENIQKTGQEMIDRGHYASDNVTT
RLSEVASLWKELLEATKQKGTQLDEANQRLQFENNAEDLQRWLEEVEWQVASEDYGKGLA
DMQNRLRKHGLLESAVAARQDQVNILTELAAYFEKIGHPDSKDIEARQESLACRFEALKE
PLATRKKKLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHKVILE
NIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESLRARAARRQNDLEANVQ
FQQYLADLHEAETWIREKEPIVDNTNYGADEEAAGALLKKHEAFLLDLNSFGDSMKALQN
QAEACQQQQAAPVEGAAGEQRVMALYDFEARSPREVTMKKGDVLTLLSSINKDWWKVEAD
DHQGFVPAVYVKRLAHDEFPMLPQRRREEPGNIAQRQEQIENQYRSLLDRAEERRRRLLQ
RYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLKTNEPRLRDINKV
ADDLLFEGLLTPEGAQIRQELNARWGSLQRLADEQRQLLGSAHAVEVFHREADDTKEQIE
KKCQALSAADPGSDLFSVQALQRQHEGFERDLVPLGDKVTILGETAERLSESHPDATEDL
QRQKMELNEAWEDLQGRTKDRKESLNEAQKFYLFLSKARDLQNWISSIAGMVSSQELAED
LTGIEILLERHQEHRADMEAEAPTFQALEDFGAELIDSEHRASPEIEKKLQAVRLERDDL
EKAWEQRKKILDQCLELQMFQGNCDQAENWMVARENALRSDDKDSLNSLEALKKKQDDLH
KAITAQEGKITDLQHFAERLIADEHYAKEEIATRLQRVLDRWKALKAQLIAEQTKLGDQA
DLKQFYRDLEELEEWISEMLPTACDESYKDPTNIQRKYLKHQAFANEVYGRADQVDATIK
LGRSLIERSTCDCDEEAMKEQLEQLKKHWDYLLEKTTDKGQKLNEASRQQRFNTSIQDFE
FWLSEAETLLAMKDQARDLASAGNLLKKHQLLETEMLAREDALKDLNTLAEDLLSSGTFN
VDQITEKKDSVNKRFLNVQDLAAAHHEKLKEAYALFQFFQDLDDEESWIQEKLLRVSSQD
YGRDLQGVQNLLKKHRRLEGELVAHEPAIQNVLDMAEKLKDKAAVGEEEIQLRLAQFVEH
WEKLKELAKARGLQLEESLEYLQFMQNAEEEEAWINEKNAMAVRGDSGDTLAATQSLLMK
HEALENDFAVHETRVQNVCAQGEDILNKVLQEESQNKEISSKIEALNEKTPSLAKAIAAW
KSQLKDDYDFQEFNWKADVVEAWIADKETSLKTNGNGADLGDFLTLLAKQDTLDASLQSF
QQERLPEITDLKDKLIAAQHSQSKAIEERYAALLKRWEQLLEASAVHRQKLLEKQLPLQK
AEDLFMEFAHKASAFNNWCEKAEENLSEPVHCVSLNEIRQLQKDHEDFLASLAGAQGDLK
CLLELDQQIKALGVPSSPYTWLTVEVLERTWKHLSDIIEEREQELQKEEARQVKNFEMCQ
EFEQNASAFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIEDLG
DNMEDALILDIKYSTIGLAQQWDQLYQLGLRMQHNLEQQIQAKDMIGVSEETLKEFSTIY
KHFDENLTGHLTHKEFLSCLRGLNYYLPMVEEDEHEPEFKKFLDAVDPGRKGYVSLEDYT
AFLIHKESENIKSSNEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPQG
RSHLSGYDYAGFTNSYFGNS
Download sequence
Identical sequences ENSPANP00000003270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]