SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003285 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003285
Domain Number 1 Region: 50-188
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.16e-38
Family Regulator of G-protein signaling, RGS 0.0000935
Further Details:      
 
Domain Number 2 Region: 357-459
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.17e-33
Family Ras-binding domain, RBD 0.000043
Further Details:      
 
Domain Number 3 Region: 301-370
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-20
Family Ras-binding domain, RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003285   Gene: ENSPANG00000011467   Transcript: ENSPANT00000027099
Sequence length 596
Comment pep:known_by_projection chromosome:PapAnu2.0:6:170725904:170740555:1 gene:ENSPANG00000011467 transcript:ENSPANT00000027099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQP
VASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARN
IYQEFLSSQALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
RECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEELGQPPVEGPGSRPLR
KSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPG
KYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCT
VLADQEVRLENRITFELELTALDRVVRISAKPTKRLQEALQPILEKHGLSPLQVVLHRPG
EKEPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPS
SLVKAPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKRLILSRFSAAAYSRGPAP
GRTHPQTESAAQPHRGILELHHRLSPLTATQQSRTAAWHPAGRACHGSALHALSVP
Download sequence
Identical sequences ENSPANP00000003285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]