SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003300 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003300
Domain Number 1 Region: 32-156
Classification Level Classification E-value
Superfamily Cupredoxins 2.49e-46
Family Ephrin ectodomain 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003300   Gene: ENSPANG00000005174   Transcript: ENSPANT00000026283
Sequence length 224
Comment pep:novel chromosome:PapAnu2.0:1:128899082:128909360:1 gene:ENSPANG00000005174 transcript:ENSPANT00000026283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGQDPILPQISLTMPFPICVWKAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYL
DIYCPHYNSEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSL
GYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASNRTPGKKPVPTLPQFTMGPNVKINV
LEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Download sequence
Identical sequences ENSPANP00000003300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]