SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003321 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000003321
Domain Number - Region: 51-91
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0445
Family Apolipoprotein A-I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003321   Gene: ENSPANG00000009164   Transcript: ENSPANT00000026250
Sequence length 198
Comment pep:known_by_projection chromosome:PapAnu2.0:X:21140124:21205889:-1 gene:ENSPANG00000009164 transcript:ENSPANT00000026250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL
EESISQLRHYCEPYTTWCQETYSQTKPKMQNLVQWGLDSYDYLQNAPPGFFPRLGVIGFA
GLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDL
WKENFQKPGNVKNSPGTK
Download sequence
Identical sequences A0A096MU27 A0A0D9RPI2 A0A1D5Q150 A0A2K5IA32 A0A2K5LSA9 A0A2K5X7S8 A0A2K6B022
ENSMMUP00000021484 ENSMMUP00000021484 9544.ENSMMUP00000021484 NP_001244561.1.72884 XP_005593235.1.63531 XP_005593236.1.63531 XP_007989497.1.81039 XP_007989498.1.81039 XP_011733657.1.29376 XP_011733658.1.29376 XP_011790506.1.43180 XP_011891024.1.92194 XP_011891025.1.92194 XP_014982575.1.72884 XP_014982576.1.72884 XP_015298966.1.63531 ENSPANP00000003321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]