SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003370 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003370
Domain Number 1 Region: 264-577
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.44e-72
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000958
Further Details:      
 
Domain Number 2 Region: 583-751
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 9.38e-38
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0001
Further Details:      
 
Domain Number 3 Region: 80-188
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000000246
Family Glutathione S-transferase (GST), C-terminal domain 0.0062
Further Details:      
 
Domain Number 4 Region: 783-835
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000000000471
Family a tRNA synthase domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003370
Domain Number - Region: 1-69
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00635
Family Glutathione S-transferase (GST), N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003370   Gene: ENSPANG00000009140   Transcript: ENSPANT00000005070
Sequence length 841
Comment pep:known_by_projection chromosome:PapAnu2.0:11:53063027:53088837:1 gene:ENSPANG00000009140 transcript:ENSPANT00000005070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFVSQGAPGCLPVLAAAGRARGRAELLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRA
LTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQE
PCQRAAETVLKQQGVLALRPYLQKQPQPSPAEGRAVTNEPEEEELATLSEEEIAMAVTAW
EKGLESLPPLRPQQNPVLPVTGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHIIHADIYRWFNISFDTFGRTTTP
QQTKSLSVKSADHAPWCSRPITLFLDLPKLEKRLEEWLGRTLPGSDWTPNARFITRSWLR
DGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWWKNPEQVD
LYQFMAKDNVPFHGIVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGVGVFGDMA
QDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNLGNFINRAGMFVSKFFGG
YVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVRIRDALRSILTISRHGNQYIQVNEPWKR
IKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSILLTNFLC
TLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQLEETFDLKAKTSPKPTVIETVTTAGP
QQIQALMDEVTKQGNIVRELKAQKADKNQVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKK
K
Download sequence
Identical sequences ENSPANP00000003370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]