SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003377 from Papio anubis 76

(show help)
Strong hits

Sequence:	ENSPANP00000003377
Domain Number 1	Region: 188-254
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	1.48e-20
Family	LIM domain	0.0013
Further Details:

Domain Number 2	Region: 129-191
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	8.58e-18
Family	LIM domain	0.00083
Further Details:

Domain Number 3	Region: 7-71
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000286
Family	LIM domain	0.018
Further Details:

Domain Number 4	Region: 67-132
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000000265
Family	LIM domain	0.0023
Further Details:

Domain Number 5	Region: 251-277
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000272
Family	LIM domain	0.011
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSPANP00000003377 Gene: ENSPANG00000010240 Transcript: ENSPANT00000026659
Sequence length	280
Comment	pep:known_by_projection chromosome:PapAnu2.0:1:40275568:40283777:-1 gene:ENSPANG00000010240 transcript:ENSPANT00000026659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSESFDCAKCSESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRH FHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQ TWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQP WHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFE DRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Download sequence
Identical sequences	A0A0D9S7Q3 A0A1D5QLX7 A0A2I3LU28 A0A2K5MFS1 A0A2K6AER6 F6YQN7 G1RM43 G3QK59 G7NUB3 H2N7X1 H2PYQ1 ENSNLEP00000014307 ENSPTRP00000000981 ENSPTRP00000000981 ENSPPYP00000001754 ENSPANP00000003377 ENSPPYP00000001754 ENSMMUP00000030540 ENSCJAP00000004027 ENSCJAP00000004027 ENSGGOP00000002827 NP_001252603.1.72884 XP_002811062.1.23681 XP_002811063.1.23681 XP_003273347.1.23891 XP_003273348.1.23891 XP_003308038.1.37143 XP_004025544.1.27298 XP_007977513.1.81039 XP_007977514.1.81039 XP_008966708.1.60992 XP_008966709.1.60992 XP_009452419.1.37143 XP_009452422.1.37143 XP_011934784.1.92194 XP_011934785.1.92194 XP_014991054.1.72884 XP_017830066.1.60252 XP_513331.2.37143 ENSNLEP00000014307 ENSMMUP00000030540 ENSGGOP00000002827 9544.ENSMMUP00000030540 9598.ENSPTRP00000000981 9600.ENSPPYP00000001754

SEARCH