SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003385 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003385
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily Cupredoxins 9.73e-46
Family Ephrin ectodomain 0.000000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003385   Gene: ENSPANG00000025087   Transcript: ENSPANT00000011741
Sequence length 191
Comment pep:known_by_projection chromosome:PapAnu2.0:6:101063557:101115440:-1 gene:ENSPANG00000025087 transcript:ENSPANT00000011741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFSNRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGF
KRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVF
VRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAI
LLFLLAMLLTL
Download sequence
Identical sequences ENSPANP00000003385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]