SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003398 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003398
Domain Number 1 Region: 333-553
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000361
Family Atu3015-like 0.078
Further Details:      
 
Domain Number 2 Region: 816-1027
Classification Level Classification E-value
Superfamily TPR-like 0.0000288
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003398
Domain Number - Region: 244-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0384
Family Atu3015-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003398   Gene: ENSPANG00000019703   Transcript: ENSPANT00000008649
Sequence length 1316
Comment pep:novel chromosome:PapAnu2.0:11:103067889:103142016:-1 gene:ENSPANG00000019703 transcript:ENSPANT00000008649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQKTNENVQRYTQFLQKPQKPIQPYICSTLNDFQEERDFLANNIFPQLNELCNSRGTYF
KAVDLSWSELKAPKSLPTHLFRQYSCLRSQHLKLCLDYVNSCFPFFICMLGQTYGDFLPD
YSHFMTSKVTRLSSLSKVEQNLYVAAKNGYPWVLENPNCSLTEFEIIQAAFLNESQFQYF
YFRTGTTLLKASDDEEKGESLPSSSSTNEEEKLRIGKLKAKIISKGLPVRFYSGLHELGE
LVFKDWSVVIEKLHPATLMIENIDYKHSFERFYHEEFTEKCKQMFVISKESDRTFEILEK
FALKDVELDFNNVAAGSSLDSVPRINPIPTYKSILLLSGEHGCGKSTLIANWVNYFKKKH
PSMLLIPHFVGSTCESSDIMSVIHYFITELQYRNYGTQLETDILNEDSDDLVFSLLVEVF
IASISLKPCVLVLDGIEELIGIYGISGQKAKDFSWLPHSLSPHCRFIMSTVSSSLSYKSL
CARPDVRTVELISTGDEETKLNIFRKHLSIPNMDPFQQSRQSLRKKPDLSPLKLTILANE
LKECRIYHNEFQCMKEYLEAVSVQELWELVLKRWIEDYSWTFQPKRSNSDTVASGEGLDG
WVADALCLLCLSHGGLAEDELLQLLDMLGYRNHCKVATLHWAAFRNATKQWVQEKPNGLL
YFWHQSLRSAVEHKLLGVIAPVRESSPCSFQSPMNHKKTYFHQVLIRYFQRQTSFWRVYQ
ELPWHMKMSGCLRGLCGFLSSPRSITDFISKIQSPGFWTRLHLIHFWNVLLEAGYDVSEA
YLLSAAKIKADQCHTMRKSCILSVLQCRLIELTVPDKCRLMFFIGSFLKFMGKTNEAEEL
LLSVEDMLVQSQSMTDMLLKVQNAIGELYLEAGMTQEGFQYFQKAWSSMLHLSLSDLEDS
RDLVKQKVRVLNNLAKSASEEYLKENHILEYATEISNLLDNNPCNQATMKYIEGVLMFVA
GNTSLAKMKLQECLNIRKSLFGKKNMLVGEVMEFLADLLFFPQRDSKKSQRKQVLKYYKQ
VIKIKENAETLAKSSLLRKQLNISLSDTLCKLAGQLLASDSCHHVMIEAVGYLYRSLDLR
VIHLGSSHSSIHGILHLLREIEWIRSRRCWPQGMSQQHSEGSRNGFSLWEHLLKLNYHSA
QSSNTVSSAMCMNADKLHRARRMDLAPQTISDKSKCAAGKGKKKPIICISAEEKIQRKTQ
NHAEIWNGSGKEASNKKKDYSSNILSLGKMNGLIKLSRQRILLAKSESGEGEITANYHHS
LPRPLSTKNPWEYELISEKWLFHSPDYISISQKSFLQRRFHTATKLLKTSDDINKE
Download sequence
Identical sequences ENSPANP00000003398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]