SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003417 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003417
Domain Number 1 Region: 547-682
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.54e-40
Family Synaptotagmin-like (S variant) 0.00000034
Further Details:      
 
Domain Number 2 Region: 379-512
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.3e-36
Family Synaptotagmin-like (S variant) 0.0032
Further Details:      
 
Domain Number 3 Region: 45-163
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.49e-31
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003417   Gene: ENSPANG00000005557   Transcript: ENSPANT00000006022
Sequence length 690
Comment pep:known_by_projection chromosome:PapAnu2.0:11:111996052:112115823:1 gene:ENSPANG00000005557 transcript:ENSPANT00000006022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTVFSNSSNRWMYPSDRPLQSKVQAGWSIHPSGQPDRQRKQEELTDEEKEIINRVIAR
AEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCT
KCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPVSEP
AAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGSYGPPVRRASEARMGSS
SRDSESWDHSGGAGDSSRSPAGLRRANSVQASRPAPGSVQSPTPPQPGQPGTPGGSRTGP
GPAGRFPDQKPEVAPSDPGTAAPPREERTGGVGGYPAVGAREDRMSHPSGPYSQASAAAP
QPAAARQPPPPEEEEEEANSYDSDEATTLGALEFSLLYDQDNSSLQCTIIKAKGLKPMDS
NGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLVYHGITDEDMQRKTLRISVCD
EDKFGHNEFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVER
VGDLEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKH
KTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGER
LKHWYECLKNKDKKIERWHQLQNENHVSSD
Download sequence
Identical sequences A0A096MUB6
ENSPANP00000003417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]