SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003437 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003437
Domain Number 1 Region: 319-353
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000785
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003437   Gene: ENSPANG00000019012   Transcript: ENSPANT00000024415
Sequence length 386
Comment pep:known_by_projection chromosome:PapAnu2.0:12:80253945:80266571:1 gene:ENSPANG00000019012 transcript:ENSPANT00000024415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKVYSTGSRAKDHQPSGVECLPLPEANAEAIDFLSSLHEEELQMLFFSESLAMVSDTG
EPQGELTIEVQRGKYQEKLGVLTSCLFVHAFSRGFLDKMLCGNSLLGYLSEKLELMEQHS
QDFIKFLILPMERKTSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFVSEAANLVL
LRVMAWRRMVPSNARFLALDTEGKLCYLTYQDLGFQTIQVDHQQAEVFIVEQTVHSEEGI
PMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREVDEIEPRPVFEKKPPVWEEDMELY
SKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDPRRPS
SPALGSSHRPNPFRSLEPEGDARSGA
Download sequence
Identical sequences ENSPANP00000003437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]