SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003441 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003441
Domain Number 1 Region: 46-247
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 16-52
Classification Level Classification E-value
Superfamily PH domain-like 0.00000152
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003441
Domain Number - Region: 564-654
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000513
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003441   Gene: ENSPANG00000008484   Transcript: ENSPANT00000006285
Sequence length 667
Comment pep:known_by_projection chromosome:PapAnu2.0:5:77455964:77527221:1 gene:ENSPANG00000008484 transcript:ENSPANT00000006285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYCVFTGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVR
YEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNT
DVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYN
LLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSMMI
SKHDCLFPKDAELQSKPQDGVSNNNNEIQKKATMGQLQNKENNNTKNSPGRQCSWDKSES
PQRSSMDNGSPTALSGSKTNSPRNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSS
NAEGLEKAQTTPNGSLQSRRTSSLKGSGTKMGTHSVQNGTVRMGILNSDTHGNPANGRNM
SWLPNGYVTLRDNKQKEQAGESGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCE
ISLPENSNSCRSSTTTCPEQDFYGGNFEDPVLDGPPQEDLSHPRDYESKSDHRSVGGRSS
RATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMM
SLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTER
GNTIWIQ
Download sequence
Identical sequences ENSPANP00000003441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]