SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003458 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003458
Domain Number 1 Region: 24-186,213-337
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.75e-61
Family FCH domain 0.0029
Further Details:      
 
Domain Number 2 Region: 500-695
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000743
Further Details:      
 
Domain Number 3 Region: 744-806
Classification Level Classification E-value
Superfamily SH3-domain 8.95e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003458   Gene: ENSPANG00000007865   Transcript: ENSPANT00000001755
Sequence length 1086
Comment pep:known_by_projection chromosome:PapAnu2.0:11:59432228:59597767:1 gene:ENSPANG00000007865 transcript:ENSPANT00000001755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLPFRLKRDRSNHPEASLLSSEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIE
TEYSRNLEKLAERFMAKTRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDI
YLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAES
KLKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSIVKVNKNSLQRQAKYSENKLKSIKAR
NEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLD
IIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRYQ
QLQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYL
SKPSIAKRRANQQETEQFYFMKLREYLEGSNLITKLQAKHDLLQRTLGEAGHRAEYMTTR
PPNVPPKPQKHRKSRPRSQYNTKLFNGDLETFVKDSGQVIPLIVESCIRFINLYGLQHQG
IFRVSGSQVEVNDIKNSFERVGENPLADDQSNHDINSVAGVLKLYFRGLENPLFPKERFN
DLISCIRIDNLYERALHIRKLLLTLPRSVLIVMRYLLRLNHLSQYSDENMMDPYNLAICF
GPTLMPVPEIQDQVSCQAHVNEIIKTIIIHHETIFPDAKELDGPVYEKCMAGDDYCDSPY
SEHGTLEEVDQDAGTEPHTSEDECEPIEAIAKFDYVGRSARELSFKKGASLLLYHRASED
WWEGRHNGIDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDR
HPDGYLARQRKRGEPPPPVRRPGRTSDGHCPLHPPHALSNSSVDLGSPSLASHPRGLLQN
RGLNNDSPERRRRPGHGSLTNISRHDSLKKIDSPPIRRSTSSGQYTGFNDHKPLDPETIA
QDIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRS
SEPQIRRSTSSSSDTMSTFKPMVAPRMGVQLKPPALRPKPAVLPKTNPTIGPAPPPQGPT
DKSCTM
Download sequence
Identical sequences ENSPANP00000003458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]