SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003504 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003504
Domain Number 1 Region: 283-410
Classification Level Classification E-value
Superfamily TPR-like 1.34e-23
Family Tetratricopeptide repeat (TPR) 0.0013
Further Details:      
 
Domain Number 2 Region: 151-280
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-23
Family FKBP immunophilin/proline isomerase 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003504   Gene: ENSPANG00000012120   Transcript: ENSPANT00000022017
Sequence length 470
Comment pep:known_by_projection chromosome:PapAnu2.0:19:17079366:17094305:-1 gene:ENSPANG00000012120 transcript:ENSPANT00000022017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAAAEANGHGRGGAKRPNLVPEARRPRLGAGRGAQDPKRGSRSQRANSRPPSSMAS
CAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPV
EEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVV
TVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQG
SRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAAN
SYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQ
PDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETA
LYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
Download sequence
Identical sequences ENSPANP00000003504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]