SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003528 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003528
Domain Number 1 Region: 132-244
Classification Level Classification E-value
Superfamily TPR-like 4.64e-34
Family Tetratricopeptide repeat (TPR) 0.00053
Further Details:      
 
Domain Number 2 Region: 282-394
Classification Level Classification E-value
Superfamily TPR-like 2.66e-30
Family Tetratricopeptide repeat (TPR) 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003528   Gene: ENSPANG00000004603   Transcript: ENSPANT00000009392
Sequence length 665
Comment pep:known_by_projection chromosome:PapAnu2.0:11:43395810:43435305:-1 gene:ENSPANG00000004603 transcript:ENSPANT00000009392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSANKAIELQLQVKQNAEELQDFMRDLENWEKDIKQKDMELRRQNGVPEENLPPIRNGN
FRKKKKGKAKEPSKKTKEENTKNRIKSYDYEAWAKLDVDSILDELDKDDSTHESLSQESE
SEEDGIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRL
KKFAVAESDCNLAIALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNE
LRKINQALASKENSYPEEADIVVKSTEGERKQIEAQQNKQQAISEKDRGNGFFKEGKYER
AIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTAR
TFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEKGHWDDVFLDSTQRQNVVKPI
DNPPHPGSTKPLKKVIIEETGNLIQTIDVPDSTTAAAPENNPINLANVIAATGTTSKKNS
SQDDRFPTSDTPRAKVLKIEEISDTSSLQPEANLKQDVCQSYSEKLTREIGQKPAQFATT
VLPPIPANSFQLESDFRQLKSSPDMLFQYLKQIEPSLYPKLFQKNLDPDVFNQIIKILHD
FYIEKEKPSLIFEILQRLSELKRFDMAVMFMSETEKKIAHALFNHIDKSGLKDNSVEELK
KRYGG
Download sequence
Identical sequences A0A096MUL2
ENSPANP00000003528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]