SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003536 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003536
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.52e-29
Family Ribosomal protein S14 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003536   Gene: ENSPANG00000025213   Transcript: ENSPANT00000009737
Sequence length 128
Comment pep:known_by_projection chromosome:PapAnu2.0:1:197632580:197641974:-1 gene:ENSPANG00000025213 transcript:ENSPANT00000009737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKN
TILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQL
SGIQRAMW
Download sequence
Identical sequences A0A096MUM0 A0A2K5ZC20 F7GV86 G7NVI9
XP_001104412.1.72884 ENSMMUP00000002103 ENSPANP00000003536 ENSMMUP00000002103 9544.ENSMMUP00000002103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]