SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003551 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003551
Domain Number 1 Region: 165-252
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000134
Family Tetratricopeptide repeat (TPR) 0.0000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003551   Gene: ENSPANG00000003024   Transcript: ENSPANT00000001496
Sequence length 466
Comment pep:novel chromosome:PapAnu2.0:6:125777188:125809955:-1 gene:ENSPANG00000003024 transcript:ENSPANT00000001496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKS
WANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQR
QFFPTDEDEIGAAKALMRLQDTYRLDPDTISRGELPGTKYQAVLSVDDCFGMGRSAYNEG
DYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSH
ERAGGNLRYFEQLLEEEREKMLSNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVK
LTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPK
LARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVAN
YGVGGQYEPHFDFSRNDERHTFKHLGTGNRVATFLNYVSMMCADGP
Download sequence
Identical sequences ENSPANP00000003551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]