SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003552 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000003552
Domain Number - Region: 368-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00054
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 802-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 281-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0188
Family Laminin-type module 0.035
Further Details:      
 
Domain Number - Region: 755-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0762
Family Laminin-type module 0.083
Further Details:      
 
Domain Number - Region: 409-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0884
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 542-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Laminin-type module 0.061
Further Details:      
 
Domain Number - Region: 324-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0984
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003552   Gene: ENSPANG00000006534   Transcript: ENSPANT00000028808
Sequence length 1137
Comment pep:known_by_projection chromosome:PapAnu2.0:6:121078767:121205260:1 gene:ENSPANG00000006534 transcript:ENSPANT00000028808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVISLNSCLSFICLLLCQWIGTASPLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSC
TDILNWFKCTRHRVSYRTAYRHGEKTMYRRKSQCCPGFYESGEMCVRNCSSFCGHTRCII
INTCSVHLGFIPSTATSACDGDHWGPHCTSRCQCKNGALCNPITGACHCAAGFRGWRCED
RCEQGTYGNDCHQRCQCQNGATCDHVTGECRCPPGYTGAFCEDLCPPGKHGPQCEQRCPC
QNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQECQCHNGGTCDAATGQCHCSP
GYTGERCQDECPVGTYGVLCAETCQCVNGGKCYHVSGACLCEAGFAGERCEARLCPEGLY
GIKCDKQCPCHLDNTHSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGAD
CDSVTGKCTCAPGFKGIDCSTPCRLGTYGINCSSRCGCKNDAVCSPVDGSCTCKAGWHGV
DCSIRCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGEKCELPCQDGTYGLNCAE
RCDCSHADGCHPTTGHCRCLPGWSGVHCDSVCAEGHWGPNCSLPCYCKNGASCSPDDGIC
ECAPGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVC
PSGRFGKNCAGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHN
GAFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHISGQCTCRTGF
MGRHCEQKCPAGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLN
SLSRTSTALPADSYQIGAIAGIIILVLVVLFLLALFIIYRHKQKGKESSMPAVTYTPAMR
VINADYTISGTLPHSNGGNANSHYFTNPSYHTLTQCATSPHVNNRDRMTITKSKNNQLFV
NLKNVNPGKRGPVGDCTGTLPADWKHGGYLNELGAFGLDRSYMGKSLKDLGKNSEYNSSN
CSLSSSENPYATIKDPPVLIPKSSECGYVEMKSPARRDSPYAEINNSTSANKNVYEVEPT
VSVVQGVFSNNGHLTQDPYDLPKNSHIPCHYDLLPVRDSSSSPKQEDSGGSSSSSSE
Download sequence
Identical sequences ENSPANP00000003552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]