SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003565 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003565
Domain Number 1 Region: 7-101
Classification Level Classification E-value
Superfamily EF-hand 3.04e-28
Family S100 proteins 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003565   Gene: ENSPANG00000011457   Transcript: ENSPANT00000019745
Sequence length 105
Comment pep:novel chromosome:PapAnu2.0:1:125893589:125900394:-1 gene:ENSPANG00000011457 transcript:ENSPANT00000019745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKVSSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVL
DRMMKRLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRI
Download sequence
Identical sequences A0A096MUP9 A0A2K5JQF3 A0A2K5M0U1 A0A2K5TJS4 A0A2K6C2U1 A0A2K6MLQ3 A0A2K6Q750 F7GN53
ENSMMUP00000005922 NP_001244459.1.72884 XP_005541895.1.63531 XP_007975337.1.81039 XP_010363409.1.97406 XP_010385428.1.97406 XP_011767702.1.29376 XP_011793300.1.43180 XP_011925044.1.92194 XP_017733114.1.44346 ENSMMUP00000005922 9544.ENSMMUP00000005922 ENSPANP00000003565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]