SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003591 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003591
Domain Number 1 Region: 178-240
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-20
Family LIM domain 0.0078
Further Details:      
 
Domain Number 2 Region: 237-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.21e-19
Family LIM domain 0.00077
Further Details:      
 
Domain Number 3 Region: 296-358
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.4e-17
Family LIM domain 0.001
Further Details:      
 
Domain Number 4 Region: 151-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000428
Family LIM domain 0.0098
Further Details:      
 
Domain Number 5 Region: 355-384
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000113
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003591   Gene: ENSPANG00000017207   Transcript: ENSPANT00000025854
Sequence length 386
Comment pep:known_by_projection chromosome:PapAnu2.0:14:14659183:14708045:1 gene:ENSPANG00000017207 transcript:ENSPANT00000025854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKESNLDETSEILSVQDNTSPLPAQL
VYTTNIQELNVYSEAQEPKVSPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPD
KQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCRKPIAGKVIHALGQSWHPEHFVCTH
CKEEIGSSPFFERNGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC
GEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGHKFHPEHFVCAFCLT
QLSKGIFREQNDKTYCQPCFNKLFPL
Download sequence
Identical sequences A0A2I3LS62 A0A2K6CSV3
ENSPANP00000003591 XP_011764463.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]