SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003595 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003595
Domain Number 1 Region: 153-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000111
Family Complement control module/SCR domain 0.00034
Further Details:      
 
Domain Number 2 Region: 92-163
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000008
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 3 Region: 212-275
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 409-469
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000027
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 32-98
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000144
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 365-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000223
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 300-352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000301
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003595   Gene: ENSPANG00000020676   Transcript: ENSPANT00000013216
Sequence length 539
Comment pep:novel chromosome:PapAnu2.0:1:156738036:156762849:-1 gene:ENSPANG00000020676 transcript:ENSPANT00000013216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSRLWKVSNSTLFQMMLVTVLLATVLGAGDCGPPPKLPFASPINPLYDTEFKTGTTLKY
TCHPGYGKINSSRLICDAKGSWNYSIFCAKKRCRNPELINGIVEVKKDLLLGSTIEFSCS
EGFFLIGSTTSRCQIQGKGVDWSDPLPECVIAKCEPPPDIRNGKHSGGDREFYTYASSVT
YTCNPYFSLIGNASISCTVENKTIGVWSPNPPICEKIVCRRPQIPKAIFVSGFGPLYTYK
DSIVVNCEEGYSLRGSSLIYCEANNEWYPSVPSCVSRVDACTDLPDISYASWERNDYNLS
DHEIFEIGTELKYLCKPGYRPVLDEPLTVTCQENLTWTSSNECERVCCPTPDLENIRIIN
ERRYFTGRCVYAYGDNISYMCDEGYYPVSVDGESSCHTDGTWKPKMPACEPALCLKPEIV
NGRLSVDKDQYVEPENVTIECDSGYGVIGPKSITCSETRTWYPEVPRCDWEAPEGCEQVL
TGRKLMQCLPSPEDVKVALEVYKLSLEIKQLEKERDKLMKTHQKFSEKEEMKDLFFPSN
Download sequence
Identical sequences ENSPANP00000003595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]