SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003607 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003607
Domain Number 1 Region: 1158-1454
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.71e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000218
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003607
Domain Number - Region: 520-711
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0146
Family BAR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003607   Gene: ENSPANG00000021916   Transcript: ENSPANT00000001685
Sequence length 1632
Comment pep:known_by_projection chromosome:PapAnu2.0:2:87963531:87999205:-1 gene:ENSPANG00000021916 transcript:ENSPANT00000001685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPR
DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL
VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF
TMDVIGGKFNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
VPMAAHEASSLYSEEKAKLLREMMAKIEDKNEVLDQFMDSMQLDPETVDNLDAYSHIPPQ
LMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQT
GATSVPSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAAL
PTPALTPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEMKK
LFEEQLKKYDQLKVYLEQNLAAQDRVLRALTEANVQYAAVRRVLSDLDQKWNSTLQTLVA
SYEAYEDLMKKSQEGRDFYADLESKVAALLERTQSTCQAREAARQQLLDRELKKKPPPRP
TAPKPLLPRREESEAMEAGDPPEELRSLPPDMVAGPRLPDTFLGTATPLHFPPSPFPSST
GPGPHYLSGPLPPGTYSGPTQLIQPRAPGPAAMPVAPGPALYPAPAYTPELGLVPRSSPQ
HGVVSSPYVGVGPAPPVAGLPSAPPPQFSSPELTMVVRPATTTVDSIQAPIPSHTAPRPN
PTTAPPQPCFPVPPPQSLPTPYTYPVGTKQPVPAQHHFSPGIPAGFPAPRIGPQPQPHPS
RAFGPQPPQQPLPLQHPHLFPPHAPGLLPPQSPYPYAPQPGVLGQPPTPLHTQLYPGPAQ
DPLPAHSGALPFPSPGPPQPPHPPLAYGPAPSARPVGPQAAPLTIRGPSPAGQPTPSPHL
VPSPAPSPGPGSVPPRPPAAEPPPCLRRGAAAADLLSSSPESQHGSTQPPGGGQPLLQPT
KVDAAEGRRPQALRLIERDPYEHPERLRQLQQELEAFRGQLGDVGALDTVWRELQDAQEH
DARGRSIAIARCYSLKNRHQDVMPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLVATQA
PLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHGALSLALSSVR
STETHVERVLSLQFRDQSLKRSLVHLHFPTWPELGLPDSPSNLLHFIQEVHAHYLHQRPL
HTPIVVHCSSGVGRTGAFALLYAAVQEVEAGNGIPELPQLVRRMRQQRKHMLQEKLHLRF
CYEAVVRHVEQVLQRHGVPPPCKPLASASISQKNHLPQDSQDLVLGGDVPISSIQATIAK
LSIRPPGGLESPVASLPGPAEPPGLPPASLPESTPIPSSSPPPLSSPLPEAPQPKEEPPV
PEAPSSGPPSSSLELLASLTPEAFSLDSSLRGKQRMSKQNFLQAHNGQGLRATQPSDDPL
SLLDPLWTLNKT
Download sequence
Identical sequences A0A096N5P7
ENSPANP00000003607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]