SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003611 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003611
Domain Number 1 Region: 347-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 2 Region: 986-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000977
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 3 Region: 783-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 4 Region: 831-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 877-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 6 Region: 938-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 7 Region: 522-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 283-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 9 Region: 470-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 10 Region: 435-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000257
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 11 Region: 1095-1138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 12 Region: 1038-1092
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.0036
Further Details:      
 
Domain Number 13 Region: 1143-1191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003611
Domain Number - Region: 1580-1781
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003611   Gene: ENSPANG00000016084   Transcript: ENSPANT00000006382
Sequence length 1798
Comment pep:known_by_projection chromosome:PapAnu2.0:2:86180316:86192915:1 gene:ENSPANG00000016084 transcript:ENSPANT00000006382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELTSREGGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDPLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEATGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLNVVERLVTPGETPSWTGSGFV
RLREGQALEFLVASVPKAMDYDLLLRLEPQVPEQWAELELTVQRPGPVPAHSLCGHVLPK
DDRIQGTLQPHTRYMVFPNPVCLEPAISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL
LPRALVLEMFSGGNAAALERRATFERYQCHEEGLVPSKISPSEACAPLLLSLSTLIYNGA
LSCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSPEGALS
SLCEKTSGQCPCRTGAFGLHCDRCQRGQWGFPSCRPCVCNGHADECDTHTGACLGCRDHT
GGEHCERCIAGFHGDPQLPYGGQCRPCPCPEGPGSQRHFATSCHRDEYSQKIVCHCRAGY
TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDLMDPDACDPHTGQCLRCLHHTEGPHCA
HCKPGFHGQATRQSCHRCTCNLLGTNPQQCPSPDQCHCDRSSGQCPCLPNVQGPSCDHCA
PNFWNFTSGHGCHPCACHPRQARGPTCNEFTGQCYCRAGFGGRTCSECQELHWGDPGLQC
RACDCDPRGTDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGFFPACHPCHACFGDWDRV
VQDLAARTRRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE
ATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL
LKHSNFLGAYDSIRHAHSQSAEAERCANTSALAVPSPVSNSASARHRTEALMDAQNEDFN
SKHMANQRALRKLSAHTHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
SCNGAVATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
SRGQVEQANQELRELVQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSRAEGEKQKAETVQAALEEAQRAQGV
AQGAIRGAVADTRDTEQTLYQVQERMAGAEQALSSAGERARQLDALLEALKLKRAGNSLA
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARD
LLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
Download sequence
Identical sequences A0A096MUU2
ENSPANP00000003611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]