SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003617 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003617
Domain Number 1 Region: 16-88
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000133
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003617
Domain Number - Region: 255-286
Classification Level Classification E-value
Superfamily SAP domain 0.000183
Family SAP domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003617   Gene: ENSPANG00000008855   Transcript: ENSPANT00000029145
Sequence length 501
Comment pep:known_by_projection chromosome:PapAnu2.0:2:51226036:51306060:1 gene:ENSPANG00000008855 transcript:ENSPANT00000029145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLAEPQWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQC
PTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQLTLESPPKSPASSSSKNLAVKVYTPV
ASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFTSQKEASPAAKTKETRSVEEMAP
DPSEVKRPETPSTSTLKHITKENTVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSV
HKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSA
AEIVQEIENMEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKCEFQLLVDQA
RKGYKKIVGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSSKLVTNHFSQSKLDSAEELE
PDREEDSSSCTDIQEALSSPESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQ
NRRTRAAESAEIEPRNKRNRN
Download sequence
Identical sequences ENSPANP00000003617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]