SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003646 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003646
Domain Number 1 Region: 288-422
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.68e-34
Family Synaptotagmin-like (S variant) 0.000000716
Further Details:      
 
Domain Number 2 Region: 146-270
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.12e-32
Family Synaptotagmin-like (S variant) 0.00000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003646   Gene: ENSPANG00000004800   Transcript: ENSPANT00000026662
Sequence length 425
Comment pep:known_by_projection chromosome:PapAnu2.0:18:35233443:35245885:-1 gene:ENSPANG00000004800 transcript:ENSPANT00000026662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGV
DIYPENLNSKKKFGADDKNEVKNKPTVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLEN
ATPKLFLEGEKEAVSPDSLKSSTSLSSEEKQEKLGTLFFSLEYNFEKKAFVVNIKEARGL
PAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHF
TILSFDRFSRDDVIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQST
TNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVF
DIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWH
VLCDG
Download sequence
Identical sequences A0A096MUX7
ENSPANP00000003646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]