SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003728 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003728
Domain Number 1 Region: 440-582
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 336-441
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-37
Family Second domain of FERM 0.00000293
Further Details:      
 
Domain Number 3 Region: 255-335
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-27
Family First domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003728   Gene: ENSPANG00000006867   Transcript: ENSPANT00000028644
Sequence length 1010
Comment pep:known_by_projection chromosome:PapAnu2.0:18:7848030:7999642:1 gene:ENSPANG00000006867 transcript:ENSPANT00000028644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGEGAGEARPSSKWKSRAKAIGIGSCLQASSAEPDPAPGRRRLCPCNCPEVLRWPPP
PRLGGQAGRGWLSLRGLWAWAPAAAPRSLGVSCNRGRGEPRRAALGCGFLPTPESPAHRR
RGRAPEPGPHAAARLGYPLIPEQSTMTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPE
PPSEEQQQALEQFASAAAHSTPVRREVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSK
LSRSPLKIAKKPKSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTY
RDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVS
GRLPCSFVTLALLGSYTVQSELGDYDPDECGSDYISEFRFAPNHTKELEDKVIELHKSHR
GMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWP
KVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAP
PKKFLTLGSKFRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEI
YMKDSVSAAEVGTGQYATTKGISQTNLITTVTPEKKAEEERDEEEDKRRKGEEVTPVSAI
RHEGKTDSERTDTAADGETTATEELEKTQDDLMKHQTNISELKRTFLETSTDTAITNEWE
KRLSTSPVRLAARQEDAPMIEPLVPEEKMETKTESSGIETEPTVHRLPLSTEKVVQETML
VEERHVVHASGDASYSVGDSGDAAAQPAFTGIKGKEGSALTEGAKEEGGEEVAKAVLEQE
ETAAASREQQEEQSAAIHVSETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPV
VHTETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEK
RIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED
Download sequence
Identical sequences ENSPANP00000003728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]