SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003729 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003729
Domain Number 1 Region: 3-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.03e-73
Family IMD domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003729   Gene: ENSPANG00000020339   Transcript: ENSPANT00000016692
Sequence length 759
Comment pep:known_by_projection chromosome:PapAnu2.0:8:119563763:119743581:-1 gene:ENSPANG00000020339 transcript:ENSPANT00000016692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQK
VADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVAN
QLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKVDTLGRGDIQPQLDSALQDVNDKYLLL
EETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKL
PSSSEQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPS
SHYRYRSSNLTQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPNQLSNGFSHYSLS
SESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSWKDWAKPG
PYDQPLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPRSMTVSAATRPGEEMEAC
EELALALSRGLQLDTQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQE
ADQQEFDKSSTIPRNSDISQSYRRMFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTK
PSVRRGTIGAGPIPIKTPVIPVKTPTVPDLPGMLPAPPDGPEERGEHSPESPSVGEGPQG
VASMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQERDPPSATVSPGQIPESD
PADLSPRDTPQGEDMLNAIRRGVKLKKTTTNDRSAPRFS
Download sequence
Identical sequences A0A096MV54
ENSPANP00000003729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]