SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003731 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003731
Domain Number 1 Region: 323-398,499-602,736-826
Classification Level Classification E-value
Superfamily TPR-like 3.22e-21
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 893-1057
Classification Level Classification E-value
Superfamily TPR-like 9.62e-20
Family Tetratricopeptide repeat (TPR) 0.0083
Further Details:      
 
Domain Number 3 Region: 110-236
Classification Level Classification E-value
Superfamily TPR-like 1.9e-18
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 
Domain Number 4 Region: 1141-1306
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000133
Family Transcription factor MalT domain III 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003731   Gene: ENSPANG00000015970   Transcript: ENSPANT00000016827
Sequence length 1321
Comment pep:known_by_projection chromosome:PapAnu2.0:2:96262700:96293846:-1 gene:ENSPANG00000015970 transcript:ENSPANT00000016827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNDSCLMAGIIYYSQEKYFHHVQQTAAVGLEKFSNDPVLKFFKAYGVLKEEHIQDAIS
DLESIRHHPDVSLCSTMALIYAHKRCEIIDREAIQELEYSLKEIRKTVSGTALYYAGVFL
WLIGHHDKAKEYIDRMLKISRGFREAYVLRGWVDLTSDKPHTAKKAIEYLEQGIQDTKDV
LGLMGKAMYFMMQQNYSEALEVVNQITVTSGSFLPALVLKMQLFLARQDWEQTVEMGHRI
LEKDESNIDACQILAVHELAREGNMTTVSSLKTQKATNHVRNLIKALETREPENPSLHLK
KILVVSRLCGSHQVILGLVCSFIERTFMATPSYIHVATELGYFFILKNQVKEALLWYTEA
MKLDKDGMAGLTGIILCHILEGHLEEAEHQLEFLKEVQKSLGKSEVLIFLQALLTSKKHK
GEQETTALLKEAVELHFSSMQGLPLGSEYFEKLDPYFLVCIAKEYLLFCPKQPRLPGQIV
SPLLKQVAVILNPVVKAAPALIDPLYLMAQVRYYSGELENAQSILQRCLELDPASVDAHL
LMCQIYLAQGNFGMCFHCLELGVSHNFQVRDHPLYHLIKARALNKAGDYPEAIKTLKMVI
KLPALKKEEGRKFLGPCLQTSQRASILLELVEALRLNGELHEATKVMQDTINEFGGTPEE
NRITIANVDLVLSKGNVDVALNMLRNISPKQSCYMEAREKMANVYLQTLRDRRLYIRCYR
ELCEHLPGPHTSLLLGDALMSILEPEKALEVYDEAYRQNPHDASLASRIGQAYVKAHQYT
EAIEYYEAAQKINGQDFLCCDLAELLLKLKKINKAEKVLKQALEHDIVQDIPSMMNDVKC
LLLLAKVYESHKKEAVIETLNKALDLQSRILKRVPLEQPEMIPSQKQLAASICIQFAEHY
LAEKEYDKAVRSYKDVFSYLPTDNKVMLELAQLYLLQGHLDLCEQHCAILLQTEQNHETA
SVLMADLMFRKQKHEAAINLYHQVLEKVPDNFLVLNKLIDLLRRSGKLEDIPAFFELAKK
VSSRVPLEPGFNYCRGIYCWHIGQPNEALKFLNKARKDSTWGQSAIYHMVQICLNPDNEV
VGGEAFENQGAESNYTEKKELEQQGVSTAEKLLREFYPNSASSQTQLRLLQGLCRLATKE
KANMEAALGSFIQIAQAEKDSVPALLALAQAYVFLKQIPKARMQLKRLAKAPWVLSEAED
LEKSWLLLADIYCQGSKFDLALELLRRCVQYNKSCYKAYEYMGFIMEKEQSYKDAVTNYK
LAWKYSHHANPAIGFRLAFNYLKDKKFVEAIEICHDVLREHPNYPKIKEEILEKARRSLR
P
Download sequence
Identical sequences A0A096MV56
ENSPANP00000003731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]