SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003752 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003752
Domain Number 1 Region: 1134-1289,1328-1407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-40
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1458-1707
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 686-833,867-914
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 56-201,291-360
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-29
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003752
Domain Number - Region: 1714-1753
Classification Level Classification E-value
Superfamily EF-hand 0.1
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003752   Gene: ENSPANG00000010482   Transcript: ENSPANT00000001638
Sequence length 1932
Comment pep:known_by_projection chromosome:PapAnu2.0:12:27241111:27344020:1 gene:ENSPANG00000010482 transcript:ENSPANT00000001638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRKLAIKILVHSLFN
MLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWN
WLDFTVITFAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVM
ILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVS
MFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSW
AFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQN
QATLEEAEQKEAFQQMLEQLKKHRRSSEAAAAAASAESRDFSGAGGIGVFSESSSVASKL
SSKSEKELKNRRKKKKQKEQSGEEEKNDRVRKSESEDSIRRKGFRFSLEGSRLTYEKRFS
SPHQSLLSIRGSLFSPRRNSRASLFSFRGRTKDIGSENDFADDEHSTFEDNDSRRDSLFV
PHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGPSTLTSAGQLLPEG
TTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSIASILTNTMEELEESRQKCPPCWYKFA
NMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSV
GNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFR
LLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCK
ISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLV
VLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRKIREFIQKAFVRKQ
KALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYM
SFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAE
GEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETF
IVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNA
WCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGA
IPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESN
QTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYF
VIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPI
PRPAVRIXXXXXXXXXXQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVL
FTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARI
GRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDD
MFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGSSVKGDCGNPSVGI
FFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFI
EFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMD
ALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVSSIYK
KDKGKECDGTPIKEDTLIDKLNENSTPEKTDMTPSTTSPPSYDSVTKPEKEKFEKDKSEK
EDKGKDIRESKK
Download sequence
Identical sequences ENSPANP00000003752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]