SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003755 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003755
Domain Number 1 Region: 330-387
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.19e-20
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 8-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000288
Family KRAB domain (Kruppel-associated box) 0.0048
Further Details:      
 
Domain Number 3 Region: 614-862
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000319
Family Hermes transposase-like 0.013
Further Details:      
 
Domain Number 4 Region: 1016-1069
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000144
Family Hermes transposase-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003755   Gene: ENSPANG00000009649   Transcript: ENSPANT00000009303
Sequence length 1169
Comment pep:known_by_projection chromosome:PapAnu2.0:3:171513820:171540561:1 gene:ENSPANG00000009649 transcript:ENSPANT00000009303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRESGKAPVTFDDITVYLLQEEWVLLSQQQKELCGSDKLVAPLGPTVANPELFCKFGP
GPEPWLGSVQGQRSHLEHHQGKKQMGYMEDMGVQGPTRESGQSLPPKKKARLSHLSTCSG
HIEGDWAGRNRKLLKPRSIQKSWFVQFPWLIMNEEQTALFCSACREYPSIRDKRSRLIEG
YTGPFKVETLKYHAKSKAHMFCVDALAARDPIWAARFRSIRDPSGDVLASPEPLFTADYP
IFYPPGPLGGFDSMAELLPSSRAELEDPGGNGAIPAMYLDCISDLRQKEVTDGIHSSSDI
DILCNDAVESCIQDPSAEGLSEEVPVVFEELPVVFEDVAVYFTREEWGMLDKRQKELYRD
VMRMNYELLASLGPAAAKPDLISKLERRAAPWIKDPNGPKWGKGRPPGNKKMVAVREADT
QALAADSALLPASPVEARASCCSPSICEGEGDGPRRIKRTYRPRSIQRSWFGQFPWLVID
PKETKLFCSACKERPNLHDKSSRLVRGYTGPFKVETLKYHEVSKAHRLCVNTVEIKEDTP
HTALIPEISSDLMANMEHFFNAAYSIAYHSRPLNDFEKILQLLQSTGTMILGKYRNRTAC
TQFIKYISETLKREILEDVRNSPCVSVLLDSSTDASEQACVGIYIRYFKQMEVKESYITL
APLCSETADGYFETIVSALDELDIPFRKPGWVVGLGTDGSAMLSCRGGLVEKFQEIIPQL
LPVHCVAHRLHLAVVDACGSIDLVKKCDRHIRTVFKFYQSSNKRLNELQEGAASLEQEII
RLKDLNAVRWVASRRRTLHALLGSWPALARHLQSVAEAGGQIGHRAKGMLKLMRGFHFVK
FCHFLLDFLSIYRPLSEVCQKEIVLITEVNATLGRAYVALESLRHQAGPKEEEFNASFKD
GRLHGICLDGLEVAEQRFQADREKTVLTGIEYLQQRFDADRPPQLKNMEVFDTMAWPSGI
ELASFGNDDILTLARYFKCSLPKGYSEEALLEEWLGLKAIAQHLPFSMLCKNALAQHCRF
PLLSKLMAVVVCVPISTSCCERGFKAMNRIRTDERTKLSNEVLNMLMMTAVNGVAVTEYD
PQPAIQHWFLTSSGRRFSHVYACAQVPARSPASARPRKEEMGALYVESGSQKPPIVPSRA
AVEVLKDCIMEPPERLLYPHTSQEAPGMS
Download sequence
Identical sequences A0A2I3LUD9
ENSPANP00000003755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]