SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003762 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003762
Domain Number 1 Region: 802-854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 2 Region: 852-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 3 Region: 1495-1546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000257
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 744-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 1552-1604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000146
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 6 Region: 274-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 7 Region: 905-950
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 1135-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1042-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000198
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 10 Region: 331-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 1962-2145
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000101
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0098
Further Details:      
 
Domain Number 12 Region: 401-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.081
Further Details:      
 
Domain Number 13 Region: 1602-1642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 14 Region: 1089-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000254
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 15 Region: 76-155
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000652
Family APC10-like 0.038
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003762
Domain Number - Region: 1194-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 1908-2013
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.000193
Family ADP-ribosylating toxins 0.028
Further Details:      
 
Domain Number - Region: 954-986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000265
Family Laminin-type module 0.028
Further Details:      
 
Domain Number - Region: 1452-1481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family Laminin-type module 0.076
Further Details:      
 
Domain Number - Region: 471-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 709-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00977
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 1758-1859,1890-1958
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0222
Family Apolipoprotein A-I 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003762   Gene: ENSPANG00000005014   Transcript: ENSPANT00000008210
Sequence length 2187
Comment pep:known_by_projection chromosome:PapAnu2.0:4:133078185:133503426:-1 gene:ENSPANG00000005014 transcript:ENSPANT00000008210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVCFPDYIAGSSFPPLLLKDIKGLFPAVLNLASNALITTNATCGEKGPEMYCKLVEHV
PGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIEYHYVTITLDLQQV
FQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYPRTGPPSYAK
DDEVICTSFYSKIHPLENGEIHISLINGRPSADDLSPELLEFTSARYIRLRFQRIRTLNA
DLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPATNKSRCECEHNT
CGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVARRSLSLNIHGKYI
GGGVCINCTQNTAGINCETCIDGFFRPKGVSPNYPRPCQPCHCNPIGSLNEVCVKDEKHA
RRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNEDPCFGPCNCKENVE
GGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDMSGWYLTDLSGRIR
VAPQQDDSDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGGQLTFTISYDLEEE
EEDTEHVLQFMIILEGNDLRISTAQDEVYLHPSEEHVNVLLLKEESFTIHGTHFPISRKE
FMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSVAAAVEVCQCPPGYTGS
SCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFY
GDPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGYFG
QPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAR
NCQPCRCNANGSFSEICHSQTGQCECRANVQGQRCDKCKPNMWWDPEKRFCVLCDCDPVG
SVSPQCDITGRCVCKSDFVGKQCNLGRQVHQQEEQPRRAQRVLGSPQRWAVGSSSGCPRG
AYRAPAPPGTFGLQSARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFS
FQEGGCTACECSHLGNNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTV
GSLDFQCNVNTGQCNCHPKFSGAKCTECSQGHWNYPRCSLCDCFLPGTDATTCDSETKKC
SCSDQTGQCTCKVNVEGIHCDRCQPGKFGLDAKNPLGCSSCYCFGTTTQCSEAKGLIWTW
VTLKAEQTILPLVDEALQHTTTKGIVFQHPEIVAHMDLMREDLHWEPFYWKLPEQFEGKK
LMAYGGKLKYAIYFEAREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIE
MTEKEWKYYGDDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQG
RRTAVTPPAHLIEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGH
SSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCV
TEGLDDYRCTACPRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDPVTGI
CTCRPGATGRKCDGCKHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAP
YKMLYGLENTTQELKHLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTG
QDAERTNTRAKSLGEFIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMI
KELRRKNLETQKEIAEDELVAAEGLLKKVKKLFGESRGKNEEMEKDLREKLADYKNKVDD
AWDLLREATNKIRETNLLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRL
ADEINSIIDYVEDIQTKLPPMSEELNNKIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSA
VLDGILDEAKNISFNATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKE
DAKGSLQKSFRILNEAKKLANDVKENEDHLNGLKTRIENADARNGDLLRALNDTLGKLSA
IPNDTAAKLQAVKDKARQANDTAKDVLAQIKELHQNLDGLKKNYDKLADSVAKTNAVVKD
PSKNSKISFFTAMMSLISSHCKSIPDS
Download sequence
Identical sequences ENSPANP00000003762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]