SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003764 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000003764
Domain Number - Region: 89-245
Classification Level Classification E-value
Superfamily PH domain-like 0.00016
Family Phosphotyrosine-binding domain (PTB) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003764   Gene: ENSPANG00000000406   Transcript: ENSPANT00000016835
Sequence length 466
Comment pep:known_by_projection chromosome:PapAnu2.0:3:66167763:66214772:-1 gene:ENSPANG00000000406 transcript:ENSPANT00000016835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSSCRQRRRNQNLSKEIPQTEFHTGYSMENEPGIVSPFKRVFLKGEKSRDKKAHEKVTE
RRPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRA
HQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTA
QDPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAAESKVAAEELCCLLGQVFQ
VVYTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGG
ASPHGKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINL
RQLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSS
TTNGNRATGSSDDRSAPSEGDEWDRMISDISSDIEALGCSMDQDSA
Download sequence
Identical sequences A0A096MV89 A0A0D9RT55 A0A2K5J3R7 A0A2K5TWN1 A0A2K6A8Z4 A0A2K6ECA6 H9G0F8
ENSPANP00000003764 NP_001244462.1.72884 XP_005549710.1.63531 XP_007979593.1.81039 XP_011760820.1.29376 XP_011802174.1.43180 XP_011838660.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]